| Identification |
|---|
| HMDB Protein ID
| CDBP04713 |
| Secondary Accession Numbers
| Not Available |
| Name
| Cysteine dioxygenase |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| CDO-1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in iron ion binding |
| Specific Function
| L-CYSTEINE + O(2) = 3-SULFINOALANINE |
| GO Classification
|
| Function |
| oxidoreductase activity, acting on single donors with incorporation of molecular oxygen |
| oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
| transition metal ion binding |
| iron ion binding |
| cysteine dioxygenase activity |
| oxidoreductase activity |
| ion binding |
| cation binding |
| metal ion binding |
| binding |
| catalytic activity |
| Process |
| metabolic process |
| cysteine metabolic process |
| l-cysteine metabolic process |
| cellular metabolic process |
| sulfur amino acid metabolic process |
| oxidation reduction |
| cellular amino acid and derivative metabolic process |
| cellular amino acid metabolic process |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| CDO-1 |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 56 |
| Molecular Weight
| 6589.4 |
| Theoretical pI
| 3.93 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Cysteine dioxygenase
MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPIEWAMYAKFDQY
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q16857 |
| UniProtKB/Swiss-Prot Entry Name
| Q16857_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| CDO-1 |
| GenAtlas ID
| CDO-1 |
| HGNC ID
| HGNC:1795 |
| References |
|---|
| General References
| Not Available |