| Identification |
|---|
| HMDB Protein ID
| CDBP04697 |
| Secondary Accession Numbers
| Not Available |
| Name
| Calcium-calmodulin independent nitric oxide synthase iNOS protein |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| Not Available |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in nitric-oxide synthase activity |
| Specific Function
| Not Available |
| GO Classification
|
| Function |
| catalytic activity |
| nitric-oxide synthase activity |
| monooxygenase activity |
| oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, nadh or nadph as one donor, and incorporation of one atom of oxygen |
| oxidoreductase activity |
| Process |
| cellular nitrogen compound biosynthetic process |
| nitric oxide biosynthetic process |
| oxidation reduction |
| metabolic process |
| nitrogen compound metabolic process |
| cellular nitrogen compound metabolic process |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| Not Available |
| Gene Sequence
|
>180 bp
AAGGGATTTTAACTTGCAGGTCCAAATCTTGCCTGGGGTCCATTATGACTCCCAAAAGTT
TGACCAGAGGACCCAGGGACAAGCCTACCCCTCCAGATGAGCTTCTACCTCAAGCTATCG
AATTTGTCAACCAATATTACGGCTCCTTCAAAGAGGCAAAAATAGAGGAACATCTGGCCA
|
| Protein Properties |
|---|
| Number of Residues
| 59 |
| Molecular Weight
| 6563.5 |
| Theoretical pI
| 8.22 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Calcium-calmodulin independent nitric oxide synthase iNOS protein
GILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLA
|
| External Links |
|---|
| GenBank ID Protein
| 4261926 |
| UniProtKB/Swiss-Prot ID
| Q9UM94 |
| UniProtKB/Swiss-Prot Entry Name
| Q9UM94_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| S76479 |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:7873 |
| References |
|---|
| General References
| Not Available |