| Identification |
| HMDB Protein ID
| CDBP04583 |
| Secondary Accession Numbers
| Not Available |
| Name
| ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F |
| Description
| Not Available |
| Synonyms
|
- SubName: ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F, isoform CRA_a
- SubName: cDNA, FLJ92503, Homo sapiens ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F(ATP6V1F), mRNA
|
| Gene Name
| ATP6V1F |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in proton-transporting ATPase activity, rotational mechanism |
| Specific Function
| Not Available |
| GO Classification
|
| Component |
| proton-transporting two-sector atpase complex, catalytic domain |
| proton-transporting v-type atpase, v1 domain |
| macromolecular complex |
| protein complex |
| Function |
| inorganic cation transmembrane transporter activity |
| monovalent inorganic cation transmembrane transporter activity |
| hydrogen ion transmembrane transporter activity |
| transporter activity |
| proton-transporting atpase activity, rotational mechanism |
| hydrogen ion transporting atp synthase activity, rotational mechanism |
| transmembrane transporter activity |
| substrate-specific transmembrane transporter activity |
| ion transmembrane transporter activity |
| cation transmembrane transporter activity |
| Process |
| atp biosynthetic process |
| purine nucleotide metabolic process |
| purine nucleotide biosynthetic process |
| purine nucleoside triphosphate biosynthetic process |
| purine ribonucleoside triphosphate biosynthetic process |
| metabolic process |
| nitrogen compound metabolic process |
| cellular nitrogen compound metabolic process |
| nucleobase, nucleoside, nucleotide and nucleic acid metabolic process |
| nucleobase, nucleoside and nucleotide metabolic process |
| nucleoside phosphate metabolic process |
| nucleotide metabolic process |
| atp synthesis coupled proton transport |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Chromosome:7 |
| Locus
| 7q32 |
| SNPs
| ATP6V1F |
| Gene Sequence
|
>360 bp
ATGGCGGGGAGGGGTAAGCTCATCGCAGTGATCGGAGACGAGGACACGGTGACTGGTTTC
CTGCTGGGCGGCATAGGGGAGCTTAACAAGAACCGCCATCCCAATTTCCTGGTGGTGGAG
AAGGATACAACCATCAATGAGATCGAAGACACTTTCCGGCAATTTCTAAACCGGGATGAC
ATTGGCATCATCCTCATCAACCAGTACATCGCAGAGATGGTGCGGCATGCCCTGGACGCC
CACCAGCAGTCCATCCCCGCTGTCCTGGAGATCCCCTCCAAGGAGCACCCATATGACGCC
GCCAAGGACTCCATCCTGCGCAGGGCCAGGGGCATGTTCACTGCCGAAGACCTGCGCTAG
|
| Protein Properties |
| Number of Residues
| 119 |
| Molecular Weight
| 13370.1 |
| Theoretical pI
| 5.19 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDD
IGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR
|
| External Links |
| GenBank ID Protein
| 189053355 |
| UniProtKB/Swiss-Prot ID
| A4D1K0 |
| UniProtKB/Swiss-Prot Entry Name
| A4D1K0_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AK312214 |
| GeneCard ID
| ATP6V1F |
| GenAtlas ID
| ATP6V1F |
| HGNC ID
| HGNC:16832 |
| References |
| General References
| Not Available |