| Identification |
|---|
| HMDB Protein ID
| CDBP04471 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA-directed RNA polymerases I and III subunit RPAC2 |
| Description
| Not Available |
| Synonyms
|
- AC19
- DNA-directed RNA polymerase I subunit D
- RNA polymerase I 16 kDa subunit
- RNA polymerases I and III subunit AC2
- RPA16
- RPC16
- hRPA19
|
| Gene Name
| POLR1D |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in DNA-directed RNA polymerase activity |
| Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.
|
| GO Classification
|
| Biological Process |
| termination of RNA polymerase III transcription |
| transcription elongation from RNA polymerase III promoter |
| termination of RNA polymerase I transcription |
| transcription elongation from RNA polymerase I promoter |
| transcription initiation from RNA polymerase I promoter |
| Cellular Component |
| nucleoplasm |
| Function |
| transferase activity, transferring phosphorus-containing groups |
| protein binding |
| nucleotidyltransferase activity |
| nucleic acid binding |
| dna binding |
| rna polymerase activity |
| dna-directed rna polymerase activity |
| protein dimerization activity |
| binding |
| catalytic activity |
| transferase activity |
| Molecular Function |
| DNA-directed RNA polymerase activity |
| DNA binding |
| Process |
| macromolecule biosynthetic process |
| cellular macromolecule biosynthetic process |
| metabolic process |
| biosynthetic process |
| transcription |
|
| Cellular Location
|
- Nucleus
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | RNA polymerase | Not Available |  | | Cytosolic DNA-sensing pathway | Not Available |  | | Epstein-Barr virus infection | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 13 |
| Locus
| 13q12.2 |
| SNPs
| POLR1D |
| Gene Sequence
|
>402 bp
ATGGAAGAGGATCAGGAGCTGGAGAGAAAAATATCTGGATTGAAGACCTCAATGGCTGAA
GGCGAGAGGAAGACAGCCCTGGAAATGGTCCAGGCAGCTGGAACAGATAGACACTGTGTG
ACATTTGTATTGCACGAGGAAGACCATACCCTAGGAAATTCTCTACGTTACATGATCATG
AAGAACCCGGAAGTGGAATTTTGTGGTTACACTACGACCCATCCTTCAGAGAGCAAAATT
AATTTACGCATTCAGACTCGAGGTACCCTTCCAGCTGTTGAGCCATTTCAGAGAGGCCTG
AATGAGCTCATGAATGTCTGCCAACATGTGCTTGACAAGTTTGAGGCCAGCATAAAGGAC
TATAAGGATCAAAAAGCAAGCAGAAATGAATCCACATTCTAG
|
| Protein Properties |
|---|
| Number of Residues
| 133 |
| Molecular Weight
| 11018.355 |
| Theoretical pI
| 10.248 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>DNA-directed RNA polymerases I and III subunit RPAC2
MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIM
KNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKD
YKDQKASRNESTF
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9Y2S0 |
| UniProtKB/Swiss-Prot Entry Name
| RPAC2_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AF077044 |
| GeneCard ID
| POLR1D |
| GenAtlas ID
| POLR1D |
| HGNC ID
| HGNC:20422 |
| References |
|---|
| General References
| Not Available |