| Identification |
|---|
| HMDB Protein ID
| CDBP03619 |
| Secondary Accession Numbers
| Not Available |
| Name
| Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| GNG12 |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| Involved in signal transducer activity |
| Specific Function
| Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction |
| GO Classification
|
| Component |
| cell part |
| membrane part |
| extrinsic to membrane |
| extrinsic to plasma membrane |
| heterotrimeric g-protein complex |
| Function |
| molecular transducer activity |
| signal transducer activity |
| Process |
| signaling |
| signaling pathway |
| cell surface receptor linked signaling pathway |
| g-protein coupled receptor protein signaling pathway |
|
| Cellular Location
|
- Cell membrane
- Lipid-anchor
- Cytoplasmic side (Potential)
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Corticotropin Activation of Cortisol Production |    | Not Available | | Intracellular Signalling Through Adenosine Receptor A2a and Adenosine |    | Not Available | | Vasopressin Regulation of Water Homeostasis |    | Not Available | | Excitatory Neural Signalling Through 5-HTR 4 and Serotonin |    | Not Available | | Intracellular Signalling Through Histamine H2 Receptor and Histamine |    | Not Available |
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:1 |
| Locus
| 1p31.3 |
| SNPs
| GNG12 |
| Gene Sequence
|
>219 bp
ATGTCCAGCAAAACAGCAAGCACCAACAATATAGCCCAGGCAAGGAGAACTGTGCAGCAG
TTAAGATTAGAAGCCTCCATTGAAAGAATAAAGGTTTCGAAGGCATCAGCGGACCTCATG
TCCTACTGTGAGGAACATGCCAGGAGTGACCCTTTGCTGATAGGAATACCAACTTCAGAA
AACCCTTTCAAGGATAAAAAAACTTGCATCATCTTATAG
|
| Protein Properties |
|---|
| Number of Residues
| 72 |
| Molecular Weight
| 8006.1 |
| Theoretical pI
| 9.38 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
|
| External Links |
|---|
| GenBank ID Protein
| 6563252 |
| UniProtKB/Swiss-Prot ID
| Q9UBI6 |
| UniProtKB/Swiss-Prot Entry Name
| GBG12_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AF119663 |
| GeneCard ID
| GNG12 |
| GenAtlas ID
| GNG12 |
| HGNC ID
| HGNC:19663 |
| References |
|---|
| General References
| Not Available |