| Identification |
| HMDB Protein ID
| CDBP03355 |
| Secondary Accession Numbers
| Not Available |
| Name
| Potassium voltage-gated channel subfamily E member 3 |
| Description
| Not Available |
| Synonyms
|
- MinK-related peptide 2
- Minimum potassium ion channel-related peptide 2
- Potassium channel subunit beta MiRP2
|
| Gene Name
| KCNE3 |
| Protein Type
| Transporter |
| Biological Properties |
| General Function
| Involved in voltage-gated potassium channel activity |
| Specific Function
| Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNC4/Kv3.4 is proposed to form the subthreshold voltage-gated potassium channel in skeletal muscle and to establish the resting membrane potential (RMP) in muscle cells. Associated with KCNQ1/KCLQT1 may form the intestinal cAMP-stimulated potassium channel involved in chloride secretion |
| GO Classification
|
| Component |
| membrane |
| cell part |
| Function |
| cation channel activity |
| potassium channel activity |
| voltage-gated potassium channel activity |
| transmembrane transporter activity |
| substrate-specific transmembrane transporter activity |
| ion transmembrane transporter activity |
| transporter activity |
| ion channel activity |
| Process |
| establishment of localization |
| transport |
| monovalent inorganic cation transport |
| potassium ion transport |
| ion transport |
| cation transport |
|
| Cellular Location
|
- Membrane
- Single-pass type I membrane protein
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Chromosome:1 |
| Locus
| 11q13.4 |
| SNPs
| KCNE3 |
| Gene Sequence
|
>312 bp
ATGGAGACTACCAATGGAACGGAGACCTGGTATGAGAGCCTGCATGCCGTGCTGAAGGCT
CTAAATGCCACTCTTCACAGCAATTTGCTCTGCCGGCCAGGGCCAGGGCTGGGGCCAGAC
AACCAGACTGAAGAGAGGCGGGCCAGCCTACCTGGCCGTGATGACAACTCCTACATGTAC
ATTCTCTTTGTCATGTTTCTATTTGCTGTAACTGTGGGCAGCCTCATCCTGGGATACACC
CGCTCCCGCAAAGTGGACAAGCGTAGTGACCCCTATCATGTGTATATCAAGAACCGTGTG
TCTATGATCTAA
|
| Protein Properties |
| Number of Residues
| 103 |
| Molecular Weight
| 11710.3 |
| Theoretical pI
| 9.01 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Potassium voltage-gated channel subfamily E member 3
METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMY
ILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
|
| External Links |
| GenBank ID Protein
| 4704429 |
| UniProtKB/Swiss-Prot ID
| Q9Y6H6 |
| UniProtKB/Swiss-Prot Entry Name
| KCNE3_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AF076531 |
| GeneCard ID
| KCNE3 |
| GenAtlas ID
| KCNE3 |
| HGNC ID
| HGNC:6243 |
| References |
| General References
| Not Available |