| Identification |
|---|
| HMDB Protein ID
| CDBP03347 |
| Secondary Accession Numbers
| Not Available |
| Name
| cAMP-dependent protein kinase inhibitor alpha |
| Description
| Not Available |
| Synonyms
|
- PKI-alpha
- cAMP-dependent protein kinase inhibitor, muscle/brain isoform
|
| Gene Name
| PKIA |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in cAMP-dependent protein kinase inhibitor activity |
| Specific Function
| Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains |
| GO Classification
|
| Function |
| enzyme regulator activity |
| enzyme inhibitor activity |
| protein serine/threonine kinase inhibitor activity |
| camp-dependent protein kinase inhibitor activity |
| kinase inhibitor activity |
| protein kinase inhibitor activity |
| Process |
| biological regulation |
| regulation of biological process |
| regulation of metabolic process |
| regulation of phosphorus metabolic process |
| regulation of phosphate metabolic process |
| regulation of phosphorylation |
| regulation of kinase activity |
| negative regulation of kinase activity |
| negative regulation of protein kinase activity |
| regulation of cellular metabolic process |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:8 |
| Locus
| 8q21.12 |
| SNPs
| PKIA |
| Gene Sequence
|
>231 bp
ATGACTGATGTGGAAACTACATATGCAGATTTTATTGCTTCAGGAAGAACAGGTAGAAGA
AATGCAATACATGATATCCTGGTTTCCTCTGCAAGTGGCAACAGCAATGAATTAGCCTTG
AAATTAGCAGGTCTTGATATCAACAAGACAGAAGGTGAAGAAGATGCACAACGAAGTTCT
ACAGAACAAAGTGGGGAAGCCCAGGGAGAAGCAGCAAAATCTGAAAGCTAA
|
| Protein Properties |
|---|
| Number of Residues
| 76 |
| Molecular Weight
| 7988.4 |
| Theoretical pI
| 4.18 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>cAMP-dependent protein kinase inhibitor alpha
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSS
TEQSGEAQGEAAKSES
|
| External Links |
|---|
| GenBank ID Protein
| 7208450 |
| UniProtKB/Swiss-Prot ID
| P61925 |
| UniProtKB/Swiss-Prot Entry Name
| IPKA_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| AF234641 |
| GeneCard ID
| PKIA |
| GenAtlas ID
| PKIA |
| HGNC ID
| HGNC:9017 |
| References |
|---|
| General References
| Not Available |