| Identification |
| HMDB Protein ID
| CDBP02929 |
| Secondary Accession Numbers
| Not Available |
| Name
| Putative gonadotropin-releasing hormone II receptor |
| Description
| Not Available |
| Synonyms
|
- GnRH II receptor
- GnRH-II-R
- Type II GnRH receptor
|
| Gene Name
| GNRHR2 |
| Protein Type
| Receptor |
| Biological Properties |
| General Function
| Involved in G-protein coupled receptor protein signaling pathway |
| Specific Function
| Receptor for gonadotropin releasing hormone II (GnRH II). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (Potential) |
| GO Classification
|
| Component |
| cell part |
| membrane part |
| intrinsic to membrane |
| integral to membrane |
| Function |
| gonadotropin-releasing hormone receptor activity |
| molecular transducer activity |
| signal transducer activity |
| g-protein coupled receptor activity |
| receptor activity |
| transmembrane receptor activity |
| protein-hormone receptor activity |
| Process |
| signaling |
| signaling pathway |
| cell surface receptor linked signaling pathway |
| g-protein coupled receptor protein signaling pathway |
|
| Cellular Location
|
- Cell membrane
- Multi-pass membrane protein
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Chromosome:1 |
| Locus
| 1q12 |
| SNPs
| GNRHR2 |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| 178 |
| Molecular Weight
| 19031.1 |
| Theoretical pI
| 10.11 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
- ["41-61", "78-98", "116-136", "155-175"]
|
| Protein Sequence
|
>Putative gonadotropin-releasing hormone II receptor
MSAGNGTPWGSAAGEEVWAGSGVEVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLW
SVTRREPSQLRPSPVRRLFIHLAAADLLVTFVVMPLDATWNITVQWLAVDIACRTLMFLK
LMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVH
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96P88 |
| UniProtKB/Swiss-Prot Entry Name
| GNRR2_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| GNRHR2 |
| GenAtlas ID
| GNRHR2 |
| HGNC ID
| HGNC:16341 |
| References |
| General References
| Not Available |