| Identification | 
    
      | HMDB Protein ID
       | CDBP02504 | 
    
    
      | Secondary Accession Numbers
       | Not Available | 
    
    
      | Name
       | Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2 | 
    
    
      | Description
       | Not Available | 
    
    
      | Synonyms
       | 
        - Methenyltetrahydrofolate cyclohydrolase
 
- NAD-dependent methylenetetrahydrofolate dehydrogenase
 
- NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein
 
- MTHFD2-like
  
       | 
    
    
      | Gene Name
       | MTHFD2L | 
    
    
      | Protein Type
       | Enzyme | 
    
    | Biological Properties | 
    
      | General Function
       | Involved in catalytic activity | 
    
    
      | Specific Function
       | Not Available | 
    
    
    
      | GO Classification
       | 
          
                
                  | Biological Process | 
                 
              
                | purine nucleotide biosynthetic process | 
               
              
                | methionine biosynthetic process | 
               
              
                | folic acid-containing compound biosynthetic process | 
               
              
                | histidine biosynthetic process | 
               
              
                | tetrahydrofolate interconversion | 
               
              
                | one-carbon metabolic process | 
               
                
                  | Cellular Component | 
                 
              
                | mitochondrion | 
               
              
                | mitochondrial inner membrane | 
               
                
                  | Function | 
                 
              
                | binding | 
               
              
                | catalytic activity | 
               
                
                  | Molecular Function | 
                 
              
                | methylenetetrahydrofolate dehydrogenase (NAD+) activity | 
               
              
                | methenyltetrahydrofolate cyclohydrolase activity | 
               
              
                | methylenetetrahydrofolate dehydrogenase (NADP+) activity | 
               
              
                | nucleotide binding | 
               
                
                  | Process | 
                 
              
                | folic acid and derivative metabolic process | 
               
              
                | cellular metabolic process | 
               
              
                | folic acid and derivative biosynthetic process | 
               
              
                | metabolic process | 
               
              
                | cellular aromatic compound metabolic process | 
               
           
       | 
    
    
      | Cellular Location
       | 
        Not Available
       | 
    
    
      | Pathways
       | 
          | Name | SMPDB/Pathwhiz | KEGG | | tetrahydrofolate interconversion | Not Available | Not Available |  | One carbon pool by folate | Not Available |   |   
       | 
    
    | Gene Properties | 
    
      | Chromosome Location
       | 4 | 
    
    
      | Locus
       | 4q13.3 | 
    
    
      | SNPs
       | MTHFD2L   | 
    
    
      | Gene Sequence
       | 
          Not Available
       | 
    
    | Protein Properties | 
    
      | Number of Residues
       | 289 | 
    
    
      | Molecular Weight
       | 37315.11 | 
    
    
      | Theoretical pI
       | 9.33 | 
    
    
      | Pfam Domain Function
       | 
               | 
    
    
      | Signals
       | 
        Not Available
       | 
    
    
      | 
         Transmembrane Regions
      
       | 
        Not Available
       | 
    
    
      | Protein Sequence
       | 
          >Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2
MAKHIQKEIQRGVESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILK
PKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGR
LCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGG
DATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPVT
GKTKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY 
       | 
    
    | External Links | 
    
      | GenBank ID Protein
       | 222418558   | 
    
    
      | UniProtKB/Swiss-Prot ID
       | Q9H903   | 
    
    
      | UniProtKB/Swiss-Prot Entry Name
       | MTD2L_HUMAN   | 
    
    
      | PDB IDs
       | 
        Not Available       | 
    
    
      | GenBank Gene ID
       | Not Available | 
    
    
      | GeneCard ID
       | MTHFD2L   | 
    
    
      | GenAtlas ID
       | MTHFD2L   | 
    
    
      | HGNC ID
       | HGNC:31865   | 
    
    | References | 
    
      | General References
       | Not Available |