| Identification |
|---|
| HMDB Protein ID
| CDBP02389 |
| Secondary Accession Numbers
| Not Available |
| Name
| Hematopoietic cell signal transducer |
| Description
| Not Available |
| Synonyms
|
- DNAX-activation protein 10
- Membrane protein DAP10
- Transmembrane adapter protein KAP10
|
| Gene Name
| HCST |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Transmembrane adapter protein which associates with NKG2D to form an activation receptor NKG2D-HCST in lymphoid and myeloid cells; this receptor plays a major role in triggering cytotoxicity against target cells expressing cell surface ligands such as MHC class I chain-related MICA and MICB, and UL16-binding proteins (ULBPs); these ligands are up-regulated by stress conditions and pathological state such as viral infection and tumor transformation. Functions as docking site for PI3-kinase PIK3R1 and GRB2. Interaction of ULBPs with NKG2D-DAP10 triggers calcium mobilization and activation of the PIK3R1, MAP2K/ERK, and JAK2/STAT5 signaling pathways. Both PIK3R1 and GRB2 are required for full NKG2D-HCST-mediated activation and ultimate killing of target cells. In NK cells, NKG2D-HCST signaling directly induces cytotoxicity and enhances cytokine production initiated via DAP12/TYROBP-associated receptors. In T cells, it provides primarily costimulation for TCR-induced signals. NKG2D-HCST receptor plays a role in immune surveillance against tumors and is required for cytolysis of tumors cells; indeed, melanoma cells that do not express NKG2D ligands escape from immune surveillance mediated by NK cells |
| GO Classification
|
Not Available
|
| Cellular Location
|
- Membrane
- Single-pass type I membrane protein
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:1 |
| Locus
| 19q13.1 |
| SNPs
| HCST |
| Gene Sequence
|
>282 bp
ATGATCCATCTGGGTCACATCCTCTTCCTGCTTTTGCTCCCAGTGGCTGCAGCTCAGACG
ACTCCAGGAGAGAGATCATCACTCCCTGCCTTTTACCCTGGCACTTCAGGCTCTTGTTCC
GGATGTGGGTCCCTCTCTCTGCCGCTCCTGGCAGGCCTCGTGGCTGCTGATGCGGTGGCA
TCGCTGCTCATCGTGGGGGCGGTGTTCCTGTGCGCACGCCCACGCCGCAGCCCCGCCCAA
GAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGCTGA
|
| Protein Properties |
|---|
| Number of Residues
| 93 |
| Molecular Weight
| 9489.0 |
| Theoretical pI
| 8.51 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Hematopoietic cell signal transducer
MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVA
SLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG
|
| External Links |
|---|
| GenBank ID Protein
| 15826850 |
| UniProtKB/Swiss-Prot ID
| Q9UBK5 |
| UniProtKB/Swiss-Prot Entry Name
| HCST_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| NM_014266.3 |
| GeneCard ID
| HCST |
| GenAtlas ID
| HCST |
| HGNC ID
| HGNC:16977 |
| References |
|---|
| General References
| Not Available |