| Identification | 
    
      | HMDB Protein ID
       | CDBP02323 | 
    
    
      | Secondary Accession Numbers
       | Not Available | 
    
    
      | Name
       | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 
    
    
      | Description
       | Not Available | 
    
    
      | Synonyms
       | 
        - DAD-1
 
- Defender against cell death 1
 
- Oligosaccharyl transferase subunit DAD1
  
       | 
    
    
      | Gene Name
       | DAD1 | 
    
    
      | Protein Type
       | Enzyme | 
    
    | Biological Properties | 
    
      | General Function
       | Involved in dolichyl-diphosphooligosaccharide-protein g | 
    
    
      | Specific Function
       | Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis (By similarity).
 | 
    
    
    
      | GO Classification
       | 
          
                
                  | Biological Process | 
                 
              
                | apoptotic process | 
               
              
                | negative regulation of apoptotic process | 
               
              
                | response to drug | 
               
              
                | post-translational protein modification | 
               
              
                | protein N-linked glycosylation via asparagine | 
               
              
                | response to nutrient | 
               
              
                | blastocyst development | 
               
                
                  | Cellular Component | 
                 
              
                | oligosaccharyltransferase complex | 
               
              
                | integral to membrane | 
               
                
                  | Molecular Function | 
                 
              
                | transferase activity, transferring glycosyl groups | 
               
           
       | 
    
    
      | Cellular Location
       | 
        - Membrane
 
- Multi-pass membrane protein (Potential)
  
       | 
    
    
      | Pathways
       | 
          | Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available |  | N-Glycan biosynthesis | Not Available |   |  | Protein processing in endoplasmic reticulum | Not Available |   |   
       | 
    
    | Gene Properties | 
    
      | Chromosome Location
       | 14 | 
    
    
      | Locus
       | 14q11.2 | 
    
    
      | SNPs
       | DAD1   | 
    
    
      | Gene Sequence
       | 
          >342 bp
ATGTCGGCGTCGGTAGTGTCTGTCATTTCGCGGTTCTTAGAAGAGTACTTGAGCTCCACT
CCGCAGCGTCTGAAGTTGCTGGACGCGTACCTGCTGTATATACTGCTGACCGGGGCGCTG
CAGTTCGGTTACTGTCTCCTCGTGGGGACCTTCCCCTTCAACTCTTTTCTCTCGGGCTTC
ATCTCTTGTGTGGGGAGTTTCATCCTAGCGGTTTGCCTGAGAATACAGATCAACCCACAG
AACAAAGCGGATTTCCAAGGCATCTCCCCAGAGCGAGCCTTTGCTGATTTTCTCTTTGCC
AGCACCATCCTGCACCTTGTTGTCATGAACTTTGTTGGCTGA 
       | 
    
    | Protein Properties | 
    
      | Number of Residues
       | 113 | 
    
    
      | Molecular Weight
       | 12496.55 | 
    
    
      | Theoretical pI
       | 7.076 | 
    
    
      | Pfam Domain Function
       | 
               | 
    
    
      | Signals
       | 
        Not Available
       | 
    
    
      | 
         Transmembrane Regions
      
       | 
        Not Available
       | 
    
    
      | Protein Sequence
       | 
          >Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 
       | 
    
    | External Links | 
    
      | GenBank ID Protein
       | 29501770   | 
    
    
      | UniProtKB/Swiss-Prot ID
       | P61803   | 
    
    
      | UniProtKB/Swiss-Prot Entry Name
       | DAD1_HUMAN   | 
    
    
      | PDB IDs
       | 
        Not Available       | 
    
    
      | GenBank Gene ID
       | AY259117   | 
    
    
      | GeneCard ID
       | DAD1   | 
    
    
      | GenAtlas ID
       | DAD1   | 
    
    
      | HGNC ID
       | HGNC:2664   | 
    
    | References | 
    
      | General References
       | Not Available |