| Identification |
|---|
| HMDB Protein ID
| CDBP02026 |
| Secondary Accession Numbers
| Not Available |
| Name
| Cardiac phospholamban |
| Description
| Not Available |
| Synonyms
|
- PLB
|
| Gene Name
| PLN |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in calcium channel regulator activity |
| Specific Function
| Phospholamban has been postulated to regulate the activity of the calcium pump of cardiac sarcoplasmic reticulum |
| GO Classification
|
| Component |
| membrane |
| cell part |
| Function |
| channel regulator activity |
| calcium channel regulator activity |
| enzyme regulator activity |
| enzyme inhibitor activity |
| atpase inhibitor activity |
| Process |
| di-, tri-valent inorganic cation transport |
| divalent metal ion transport |
| calcium ion transport |
| establishment of localization |
| transport |
| ion transport |
| cation transport |
|
| Cellular Location
|
- Mitochondrion membrane
- Single-pass membrane protein
- Sarcoplasmic reticulum
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Muscle/Heart Contraction |    | Not Available | | Acebutolol Action Pathway |    | Not Available | | Alprenolol Action Pathway |    | Not Available | | Atenolol Action Pathway |    | Not Available | | Betaxolol Action Pathway |    | Not Available |
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:6 |
| Locus
| 6q22.1 |
| SNPs
| PLN |
| Gene Sequence
|
>159 bp
ATGGAGAAAGTCCAATACCTCACTCGCTCAGCTATAAGAAGAGCCTCAACCATTGAAATG
CCTCAACAAGCACGTCAAAAGCTACAGAATCTATTTATCAATTTCTGTCTCATCTTAATA
TGTCTCTTGCTGATCTGTATCATCGTGATGCTTCTCTGA
|
| Protein Properties |
|---|
| Number of Residues
| 52 |
| Molecular Weight
| 6108.5 |
| Theoretical pI
| 9.56 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Cardiac phospholamban
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
|
| External Links |
|---|
| GenBank ID Protein
| 5916238 |
| UniProtKB/Swiss-Prot ID
| P26678 |
| UniProtKB/Swiss-Prot Entry Name
| PPLA_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| AF177764 |
| GeneCard ID
| PLN |
| GenAtlas ID
| PLN |
| HGNC ID
| HGNC:9080 |
| References |
|---|
| General References
| Not Available |