| Identification |
|---|
| HMDB Protein ID
| CDBP01875 |
| Secondary Accession Numbers
| Not Available |
| Name
| Protein S100-A9 |
| Description
| Not Available |
| Synonyms
|
- Calgranulin-B
- Calprotectin L1H subunit
- Leukocyte L1 complex heavy chain
- MRP-14
- Migration inhibitory factor-related protein 14
- S100 calcium-binding protein A9
- p14
|
| Gene Name
| S100A9 |
| Protein Type
| Metal Binding |
| Biological Properties |
|---|
| General Function
| Involved in calcium ion binding |
| Specific Function
| Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS). Promotes tubulin polymerization when unphosphorylated. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as a pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions |
| GO Classification
|
| Function |
| binding |
| calcium ion binding |
| ion binding |
| cation binding |
| metal ion binding |
|
| Cellular Location
|
- Cell membrane
- Cytoplasm
- Cytoplasm
- Peripheral membrane protein
- Secreted
- cytoskeleton
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:1 |
| Locus
| 1q21 |
| SNPs
| S100A9 |
| Gene Sequence
|
>345 bp
ATGACTTGCAAAATGTCGCAGCTGGAACGCAACATAGAGACCATCATCAACACCTTCCAC
CAATACTCTGTGAAGCTGGGGCACCCAGACACCCTGAACCAGGGGGAATTCAAAGAGCTG
GTGCGAAAAGATCTGCAAAATTTTCTCAAGAAGGAGAATAAGAATGAAAAGGTCATAGAA
CACATCATGGAGGACCTGGACACAAATGCAGACAAGCAGCTGAGCTTCGAGGAGTTCATC
ATGCTGATGGCGAGGCTAACCTGGGCCTCCCACGAGAAGATGCACGAGGGTGACGAGGGC
CCTGGCCACCACCATAAGCCAGGCCTCGGGGAGGGCACCCCCTAA
|
| Protein Properties |
|---|
| Number of Residues
| 114 |
| Molecular Weight
| 13242.0 |
| Theoretical pI
| 6.08 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Protein S100-A9
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
|
| External Links |
|---|
| GenBank ID Protein
| 34771 |
| UniProtKB/Swiss-Prot ID
| P06702 |
| UniProtKB/Swiss-Prot Entry Name
| S10A9_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| X06233 |
| GeneCard ID
| S100A9 |
| GenAtlas ID
| S100A9 |
| HGNC ID
| HGNC:10499 |
| References |
|---|
| General References
| Not Available |