| Identification |
|---|
| HMDB Protein ID
| CDBP01591 |
| Secondary Accession Numbers
| Not Available |
| Name
| Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 |
| Description
| Not Available |
| Synonyms
|
- G gamma-I
|
| Gene Name
| GNG2 |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| Involved in signal transducer activity |
| Specific Function
| Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction |
| GO Classification
|
| Component |
| extrinsic to plasma membrane |
| heterotrimeric g-protein complex |
| cell part |
| membrane part |
| extrinsic to membrane |
| Function |
| molecular transducer activity |
| signal transducer activity |
| Process |
| signaling |
| signaling pathway |
| cell surface receptor linked signaling pathway |
| g-protein coupled receptor protein signaling pathway |
|
| Cellular Location
|
- Cell membrane
- Lipid-anchor
- Cytoplasmic side (Potential)
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Chlorphenamine H1-Antihistamine Action |    | Not Available | | Pheniramine H1-Antihistamine Action |    | Not Available | | Dexchlorpheniramine H1-Antihistamine Action |    | Not Available | | Brompheniramine H1-Antihistamine Action |    | Not Available | | Dexbrompheniramine H1-Antihistamine Action |    | Not Available |
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:1 |
| Locus
| 14q21 |
| SNPs
| GNG2 |
| Gene Sequence
|
>216 bp
ATGGCCAGCAACAACACCGCCAGCATAGCACAAGCCAGGAAGCTGGTAGAGCAGCTTAAG
ATGGAAGCCAATATCGACAGGATAAAGGTGTCCAAGGCAGCTGCAGATTTGATGGCCTAC
TGTGAAGCACATGCCAAGGAAGACCCCCTCCTGACCCCTGTTCCGGCTTCAGAAAACCCG
TTTAGGGAGAAGAAGTTTTTCTGTGCCATCCTTTAA
|
| Protein Properties |
|---|
| Number of Residues
| 71 |
| Molecular Weight
| 7850.0 |
| Theoretical pI
| 8.22 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFCAIL
|
| External Links |
|---|
| GenBank ID Protein
| 20147633 |
| UniProtKB/Swiss-Prot ID
| P59768 |
| UniProtKB/Swiss-Prot Entry Name
| GBG2_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| AF493870 |
| GeneCard ID
| GNG2 |
| GenAtlas ID
| GNG2 |
| HGNC ID
| HGNC:4404 |
| References |
|---|
| General References
| Not Available |