| Identification |
|---|
| HMDB Protein ID
| CDBP01230 |
| Secondary Accession Numbers
| Not Available |
| Name
| ATP synthase protein 8 |
| Description
| Not Available |
| Synonyms
|
- A6L
- F-ATPase subunit 8
|
| Gene Name
| MT-ATP8 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in hydrogen ion transmembrane transporter activity |
| Specific Function
| Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane |
| GO Classification
|
| Component |
| cell part |
| membrane part |
| mitochondrial proton-transporting atp synthase complex, coupling factor f(o) |
| mitochondrial membrane part |
| Function |
| substrate-specific transmembrane transporter activity |
| ion transmembrane transporter activity |
| cation transmembrane transporter activity |
| inorganic cation transmembrane transporter activity |
| monovalent inorganic cation transmembrane transporter activity |
| hydrogen ion transmembrane transporter activity |
| transporter activity |
| transmembrane transporter activity |
| Process |
| nucleoside phosphate metabolic process |
| nucleotide metabolic process |
| atp synthesis coupled proton transport |
| atp biosynthetic process |
| purine nucleotide metabolic process |
| purine nucleotide biosynthetic process |
| purine nucleoside triphosphate biosynthetic process |
| purine ribonucleoside triphosphate biosynthetic process |
| metabolic process |
| nitrogen compound metabolic process |
| cellular nitrogen compound metabolic process |
| nucleobase, nucleoside, nucleotide and nucleic acid metabolic process |
| nucleobase, nucleoside and nucleotide metabolic process |
|
| Cellular Location
|
- Mitochondrion membrane
- Single-pass membrane protein
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| MT-ATP8 |
| Gene Sequence
|
>207 bp
ATGCCCCAACTAAATACTACCGTATGGCCCACCATAATTACCCCCATACTCCTTACACTA
TTCCTCATCACCCAACTAAAAATATTAAACACAAACTACCACCTACCTCCCTCACCAAAG
CCCATAAAAATAAAAAATTATAACAAACCCTGAGAACCAAAATGAACGAAAATCTGTTCG
CTTCATTCATTGCCCCCACAATCCTAG
|
| Protein Properties |
|---|
| Number of Residues
| 68 |
| Molecular Weight
| 7991.6 |
| Theoretical pI
| 10.56 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>ATP synthase protein 8
MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICS
LHSLPPQS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P03928 |
| UniProtKB/Swiss-Prot Entry Name
| ATP8_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| J01415 |
| GeneCard ID
| MT-ATP8 |
| GenAtlas ID
| MT-ATP8 |
| HGNC ID
| HGNC:7415 |
| References |
|---|
| General References
| Not Available |