Showing Protein ATP synthase subunit epsilon, mitochondrial (CDBP01133)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 3 compounds
Identification
HMDB Protein ID CDBP01133
Secondary Accession Numbers Not Available
Name ATP synthase subunit epsilon, mitochondrial
Description Not Available
Synonyms
  1. ATPase subunit epsilon
Gene Name ATP5E
Protein Type Enzyme
Biological Properties
General Function Involved in hydrogen ion transporting ATP synthase activity, rotational mechanism
Specific Function Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits
GO Classification
Component
membrane part
mitochondrial proton-transporting atp synthase complex, catalytic core f(1)
mitochondrial membrane part
cell part
Function
proton-transporting atpase activity, rotational mechanism
hydrogen ion transporting atp synthase activity, rotational mechanism
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
transporter activity
Process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
atp synthesis coupled proton transport
atp biosynthetic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
Cellular Location
  1. Mitochondrion
  2. Mitochondrion inner membrane
Pathways
Gene Properties
Chromosome Location Chromosome:2
Locus 20q13.32
SNPs ATP5E
Gene Sequence 
>156 bp
ATGGTGGCCTACTGGAGACAGGCTGGACTCAGCTACATCCGATACTCCCAGATCTGTGCA
AAAGCAGTGAGAGATGCACTGAAGACAGAATTCAAAGCAAATGCTGAGAAGACTTCTGGC
AGCAACGTAAAAATTGTGAAAGTAAAGAAGGAATAA
Protein Properties
Number of Residues 51
Molecular Weight 5779.7
Theoretical pI 10.53
Pfam Domain Function
Signals
  • ["None"]
Transmembrane Regions
  • ["None"]
Protein Sequence 
>ATP synthase subunit epsilon, mitochondrial
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
GenBank ID Protein 8117712
UniProtKB/Swiss-Prot ID P56381
UniProtKB/Swiss-Prot Entry Name ATP5E_HUMAN
PDB IDs
GenBank Gene ID AF052955
GeneCard ID ATP5E
GenAtlas ID ATP5E
HGNC ID HGNC:838
References
General References Not Available