| Identification |
|---|
| HMDB Protein ID
| CDBP00924 |
| Secondary Accession Numbers
| Not Available |
| Name
| Cytochrome b-c1 complex subunit 9 |
| Description
| Not Available |
| Synonyms
|
- Complex III subunit 9
- Complex III subunit X
- Cytochrome c1 non-heme 7 kDa protein
- Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
|
| Gene Name
| UQCR10 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Involved in ubiquinol-cytochrome-c reductase activity |
| Specific Function
| This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1 |
| GO Classification
|
| Component |
| mitochondrial envelope |
| cell part |
| envelope |
| organelle envelope |
| Function |
| transmembrane transporter activity |
| substrate-specific transmembrane transporter activity |
| ion transmembrane transporter activity |
| cation transmembrane transporter activity |
| inorganic cation transmembrane transporter activity |
| monovalent inorganic cation transmembrane transporter activity |
| hydrogen ion transmembrane transporter activity |
| ubiquinol-cytochrome-c reductase activity |
| transporter activity |
| Process |
| metabolic process |
| generation of precursor metabolites and energy |
| electron transport chain |
| respiratory electron transport chain |
| cellular metabolic process |
| mitochondrial electron transport, ubiquinol to cytochrome c |
|
| Cellular Location
|
- Mitochondrion inner membrane
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:2 |
| Locus
| 22cen-q12.3 |
| SNPs
| UQCR10 |
| Gene Sequence
|
>192 bp
ATGGCGGCCGCGACGTTGACTTCGAAATTGTACTCCCTGCTGTTCCGCAGGACCTCCACC
TTCGCCCTCACCATCATCGTGGGCGTCATGTTCTTCGAGCGCGCCTTCGATCAAGGCGCG
GACGCTATCTACGACCACATCAACGAGGGGAAGCTGTGGAAACACATCAAGCACAAGTAT
GAGAACAAGTAG
|
| Protein Properties |
|---|
| Number of Residues
| 63 |
| Molecular Weight
| 7308.4 |
| Theoretical pI
| 9.97 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Cytochrome b-c1 complex subunit 9
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKY
ENK
|
| External Links |
|---|
| GenBank ID Protein
| 12081913 |
| UniProtKB/Swiss-Prot ID
| Q9UDW1 |
| UniProtKB/Swiss-Prot Entry Name
| QCR9_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| AB028598 |
| GeneCard ID
| UQCR10 |
| GenAtlas ID
| UQCR10 |
| HGNC ID
| HGNC:30863 |
| References |
|---|
| General References
| Not Available |