| Identification |
| HMDB Protein ID
| CDBP00708 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA-directed RNA polymerase III subunit RPC10 |
| Description
| Not Available |
| Synonyms
|
- DNA-directed RNA polymerase III subunit K
- HsC11p
- RNA polymerase III 12.5 kDa subunit
- RNA polymerase III subunit C10
- RNA polymerase III subunit C11
- RPC11
- RPC12.5
- hRPC11
|
| Gene Name
| POLR3K |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in DNA binding |
| Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).
|
| GO Classification
|
| Biological Process |
| termination of RNA polymerase III transcription |
| transcription elongation from RNA polymerase III promoter |
| defense response to virus |
| innate immune response |
| Cellular Component |
| DNA-directed RNA polymerase III complex |
| Function |
| transcription regulator activity |
| nucleic acid binding |
| dna binding |
| rna polymerase activity |
| dna-directed rna polymerase activity |
| ion binding |
| cation binding |
| metal ion binding |
| binding |
| catalytic activity |
| transition metal ion binding |
| zinc ion binding |
| transferase activity |
| transferase activity, transferring phosphorus-containing groups |
| nucleotidyltransferase activity |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| DNA-directed RNA polymerase activity |
| DNA binding |
| Process |
| regulation of gene expression |
| regulation of transcription |
| biosynthetic process |
| transcription |
| macromolecule biosynthetic process |
| cellular macromolecule biosynthetic process |
| metabolic process |
| biological regulation |
| regulation of biological process |
| regulation of metabolic process |
| regulation of macromolecule metabolic process |
|
| Cellular Location
|
- Nucleus
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | RNA polymerase | Not Available |  | | Cytosolic DNA-sensing pathway | Not Available |  | | Epstein-Barr virus infection | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| POLR3K |
| Gene Sequence
|
>327 bp
ATGCTGCTGTTCTGCCCCGGCTGCGGGAACGGGCTGATCGTGGAGGAGGGACAACGCTGC
CACCGCTTCTCCTGCAACACGTGCCCCTACGTGCACAACATCACCCGCAAGGTAACAAAT
CGGAAGTACCCAAAACTGAAAGAAGTGGATGATGTGCTTGGTGGAGCAGCTGCCTGGGAG
AATGTTGACTCTACTGCAGAGTCGTGTCCCAAATGCGAACATCCTCGTGCTTACTTCATG
CAGCTTCAGACCCGCTCTGCAGATGAGCCGATGACCACCTTCTACAAGTGCTGCAATGCT
CAGTGTGGACACCGCTGGAGGGATTAG
|
| Protein Properties |
| Number of Residues
| 108 |
| Molecular Weight
| Not Available |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>DNA-directed RNA polymerase III subunit RPC10
MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWE
NVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
|
| External Links |
| GenBank ID Protein
| 14336676 |
| UniProtKB/Swiss-Prot ID
| Q9Y2Y1 |
| UniProtKB/Swiss-Prot Entry Name
| RPC10_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AE006462 |
| GeneCard ID
| POLR3K |
| GenAtlas ID
| POLR3K |
| HGNC ID
| HGNC:14121 |
| References |
| General References
| Not Available |