| Identification |
| HMDB Protein ID
| CDBP00615 |
| Secondary Accession Numbers
| Not Available |
| Name
| Ubiquitin-conjugating enzyme E2 C |
| Description
| Not Available |
| Synonyms
|
- UbcH10
- Ubiquitin carrier protein C
- Ubiquitin-protein ligase C
|
| Gene Name
| UBE2C |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in ubiquitin-protein ligase activity |
| Specific Function
| Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
|
| GO Classification
|
| Biological Process |
| mitotic cell cycle spindle assembly checkpoint |
| negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle |
| positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle |
| protein K48-linked ubiquitination |
| protein K11-linked ubiquitination |
| cyclin catabolic process |
| free ubiquitin chain polymerization |
| positive regulation of exit from mitosis |
| spindle organization |
| phosphatidylinositol-mediated signaling |
| exit from mitosis |
| mitosis |
| cell division |
| activation of anaphase-promoting complex activity |
| anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process |
| Cellular Component |
| cytosol |
| nucleoplasm |
| anaphase-promoting complex |
| Function |
| catalytic activity |
| small conjugating protein ligase activity |
| nucleoside binding |
| purine nucleoside binding |
| adenyl nucleotide binding |
| adenyl ribonucleotide binding |
| atp binding |
| ligase activity |
| ligase activity, forming carbon-nitrogen bonds |
| acid-amino acid ligase activity |
| ubiquitin-protein ligase activity |
| binding |
| Molecular Function |
| ubiquitin-protein ligase activity |
| ATP binding |
| Process |
| biological regulation |
| regulation of biological process |
| regulation of metabolic process |
| regulation of macromolecule metabolic process |
| post-translational protein modification |
| protein modification by small protein conjugation or removal |
| protein modification by small protein conjugation |
| protein ubiquitination |
| macromolecule modification |
| protein modification process |
| metabolic process |
| regulation of protein metabolic process |
| macromolecule metabolic process |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein ubiquitination | Not Available | Not Available | | Ubiquitin mediated proteolysis | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| 20 |
| Locus
| 20q13.12 |
| SNPs
| UBE2C |
| Gene Sequence
|
>540 bp
ATGGCTTCCCAAAACCGCGACCCAGCCGCCACTAGCGTCGCCGCCGCCCGTAAAGGAGCT
GAGCCGAGCGGGGGCGCCGCCCGGGGTCCGGTGGGCAAAAGGCTACAGCAGGAGCTGATG
ACCCTCATGATGTCTGGCGATAAAGGGATTTCTGCCTTCCCTGAATCAGACAACCTTTTC
AAATGGGTAGGGACCATCCATGGAGCAGCTGGAACAGTATATGAAGACCTGAGGTATAAG
CTCTCGCTAGAGTTCCCCAGTGGCTACCCTTACAATGCGCCCACAGTGAAGTTCCTCACG
CCCTGCTATCACCCCAACGTGGACACCCAGGGTAACATATGCCTGGACATCCTGAAGGAA
AAGTGGTCTGCCCTGTATGATGTCAGGACCATTCTGCTCTCCATCCAGAGCCTTCTAGGA
GAACCCAACATTGATAGTCCCTTGAACACACATGCTGCCGAGCTCTGGAAAAACCCCACA
GCTTTTAAGAAGTACCTGCAAGAAACCTACTCAAAGCAGGTCACCAGCCAGGAGCCCTGA
|
| Protein Properties |
| Number of Residues
| 179 |
| Molecular Weight
| 19652.13 |
| Theoretical pI
| 7.371 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Ubiquitin-conjugating enzyme E2 C
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF
KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKE
KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
|
| External Links |
| GenBank ID Protein
| 5902146 |
| UniProtKB/Swiss-Prot ID
| O00762 |
| UniProtKB/Swiss-Prot Entry Name
| UBE2C_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| NM_007019.2 |
| GeneCard ID
| UBE2C |
| GenAtlas ID
| UBE2C |
| HGNC ID
| HGNC:15937 |
| References |
| General References
| Not Available |