| Identification |
| HMDB Protein ID
| CDBP00532 |
| Secondary Accession Numbers
| Not Available |
| Name
| Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma |
| Description
| Not Available |
| Synonyms
|
- GMP-PDE gamma
|
| Gene Name
| PDE6H |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in 3',5'-cyclic-nucleotide phosphodiesterase activity |
| Specific Function
| Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones.
|
| GO Classification
|
| Biological Process |
| visual perception |
| activation of MAPK activity |
| positive regulation of epidermal growth factor receptor signaling pathway |
| positive regulation of G-protein coupled receptor protein signaling pathway |
| response to stimulus |
| Function |
| cyclic-nucleotide phosphodiesterase activity |
| 3',5'-cyclic-nucleotide phosphodiesterase activity |
| nucleoside binding |
| purine nucleoside binding |
| phosphoric ester hydrolase activity |
| phosphoric diester hydrolase activity |
| hydrolase activity, acting on ester bonds |
| binding |
| catalytic activity |
| hydrolase activity |
| gmp binding |
| cgmp binding |
| Molecular Function |
| 3',5'-cyclic-GMP phosphodiesterase activity |
| cGMP binding |
| enzyme inhibitor activity |
| Process |
| multicellular organismal process |
| system process |
| neurological system process |
| sensory perception |
| sensory perception of light stimulus |
| visual perception |
|
| Cellular Location
|
- Cytoplasmic
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 12 |
| Locus
| 12p13 |
| SNPs
| PDE6H |
| Gene Sequence
|
>252 bp
ATGAGTGACAACACTACTCTGCCTGCTCCAGCTTCAAACCAGGGTCCTACCACCCCACGC
AAAGGCCCTCCCAAGTTCAAGCAGAGGCAGACTCGCCAATTCAAGAGTAAACCTCCAAAG
AAAGGTGTGAAAGGATTTGGAGATGACATTCCAGGAATGGAGGGGCTAGGAACAGATATC
ACAGTGATTTGTCCATGGGAGGCATTCAGCCACCTGGAATTGCATGAGCTCGCTCAGTTT
GGGATTATCTGA
|
| Protein Properties |
| Number of Residues
| 83 |
| Molecular Weight
| 9074.36 |
| Theoretical pI
| 9.248 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDI
TVICPWEAFSHLELHELAQFGII
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q13956 |
| UniProtKB/Swiss-Prot Entry Name
| CNCG_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| D45399 |
| GeneCard ID
| PDE6H |
| GenAtlas ID
| PDE6H |
| HGNC ID
| HGNC:8790 |
| References |
| General References
| Not Available |