| Identification |
|---|
| HMDB Protein ID
| CDBP00127 |
| Secondary Accession Numbers
| Not Available |
| Name
| NADH-ubiquinone oxidoreductase chain 4L |
| Description
| Not Available |
| Synonyms
|
- NADH dehydrogenase subunit 4L
|
| Gene Name
| MT-ND4L |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in oxidoreductase activity, acting on NADH or NADPH |
| Specific Function
| Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
|
| GO Classification
|
| Biological Process |
| small molecule metabolic process |
| mitochondrial electron transport, NADH to ubiquinone |
| Cellular Component |
| mitochondrial respiratory chain complex I |
| integral to membrane |
| Function |
| oxidoreductase activity, acting on nadh or nadph |
| catalytic activity |
| oxidoreductase activity |
| Molecular Function |
| NADH dehydrogenase (ubiquinone) activity |
| Process |
| metabolic process |
| generation of precursor metabolites and energy |
| electron transport chain |
| respiratory electron transport chain |
| atp synthesis coupled electron transport |
| cellular metabolic process |
| oxidation reduction |
|
| Cellular Location
|
- Mitochondrion membrane
- Multi-pass membrane protein
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Oxidative phosphorylation | Not Available |  | | Parkinson's disease | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| MT-ND4L |
| Gene Sequence
|
>297 bp
ATGCCCCTCATTTACATAAATATTATACTAGCATTTACCATCTCACTTCTAGGAATACTA
GTATATCGCTCACACCTCATATCCTCCCTACTATGCCTAGAAGGAATAATACTATCGCTG
TTCATTATAGCTACTCTCATAACCCTCAACACCCACTCCCTCTTAGCCAATATTGTGCCT
ATTGCCATACTAGTCTTTGCCGCCTGCGAAGCAGCGGTGGGCCTAGCCCTACTAGTCTCA
ATCTCCAACACATATGGCCTAGACTACGTACATAACCTAAACCTACTCCAATGCTAA
|
| Protein Properties |
|---|
| Number of Residues
| 98 |
| Molecular Weight
| 10741.005 |
| Theoretical pI
| 6.209 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>NADH-ubiquinone oxidoreductase chain 4L
MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVP
IAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P03901 |
| UniProtKB/Swiss-Prot Entry Name
| NU4LM_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| J01415 |
| GeneCard ID
| MT-ND4L |
| GenAtlas ID
| MT-ND4L |
| HGNC ID
| HGNC:7460 |
| References |
|---|
| General References
| Not Available |