| Identification |
|---|
| HMDB Protein ID
| CDBP00113 |
| Secondary Accession Numbers
| Not Available |
| Name
| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 |
| Description
| Not Available |
| Synonyms
|
- CI-MNLL
- Complex I-MNLL
- NADH-ubiquinone oxidoreductase MNLL subunit
|
| Gene Name
| NDUFB1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in NADH dehydrogenase activity |
| Specific Function
| Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone |
| GO Classification
|
| Component |
| mitochondrion |
| organelle |
| membrane-bounded organelle |
| intracellular membrane-bounded organelle |
| Function |
| catalytic activity |
| nadh dehydrogenase activity |
| oxidoreductase activity |
| oxidoreductase activity, acting on nadh or nadph |
|
| Cellular Location
|
- Single-pass membrane protein
- Mitochondrion inner membrane
- Matrix side
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:1 |
| Locus
| 14q32.12 |
| SNPs
| NDUFB1 |
| Gene Sequence
|
>177 bp
ATGGTGAACTTACTTCAGATTGTGCGGGACCACTGGGTTCATGTTCTTGTCCCTATGGGA
TTTGTCATTGGATGTTATTTAGACAGAAAGAGTGATGAACGGCTAACTGCCTTCCGGAAC
AAGAGTATGTTATTTAAAAGGGAATTGCAACCCAGTGAAGAAGTTACCTGGAAGTAA
|
| Protein Properties |
|---|
| Number of Residues
| 58 |
| Molecular Weight
| 6961.2 |
| Theoretical pI
| 9.34 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
MVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
|
| External Links |
|---|
| GenBank ID Protein
| 5326820 |
| UniProtKB/Swiss-Prot ID
| O75438 |
| UniProtKB/Swiss-Prot Entry Name
| NDUB1_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AF050638 |
| GeneCard ID
| NDUFB1 |
| GenAtlas ID
| NDUFB1 |
| HGNC ID
| HGNC:7695 |
| References |
|---|
| General References
| Not Available |