| Identification |
| HMDB Protein ID
| CDBP00108 |
| Secondary Accession Numbers
| Not Available |
| Name
| Nucleoside diphosphate kinase B |
| Description
| Not Available |
| Synonyms
|
- C-myc purine-binding transcription factor PUF
- NDK B
- NDP kinase B
- nm23-H2
- Histidine protein kinase NDKB
|
| Gene Name
| NME2 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in nucleoside diphosphate kinase activity |
| Specific Function
| Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically (PubMed:8392752). Exhibits histidine protein kinase activity.
|
| GO Classification
|
| Biological Process |
| lactation |
| transcription, DNA-dependent |
| response to cAMP |
| negative regulation of apoptotic process |
| nucleobase-containing small molecule interconversion |
| cell adhesion |
| response to drug |
| positive regulation of keratinocyte differentiation |
| CTP biosynthetic process |
| GTP biosynthetic process |
| UTP biosynthetic process |
| nucleoside triphosphate biosynthetic process |
| negative regulation of myeloid leukocyte differentiation |
| positive regulation of epithelial cell proliferation |
| Cellular Component |
| cytosol |
| centrosome |
| mitochondrion |
| ruffle |
| perinuclear region of cytoplasm |
| nucleus |
| lamellipodium |
| intermediate filament |
| Function |
| transferase activity, transferring phosphorus-containing groups |
| nucleoside binding |
| purine nucleoside binding |
| adenyl nucleotide binding |
| adenyl ribonucleotide binding |
| atp binding |
| nucleoside diphosphate kinase activity |
| binding |
| catalytic activity |
| phosphotransferase activity, phosphate group as acceptor |
| transferase activity |
| Molecular Function |
| metal ion binding |
| sequence-specific DNA binding transcription factor activity |
| ATP binding |
| nucleoside diphosphate kinase activity |
| protein histidine kinase activity |
| DNA binding |
| Process |
| purine nucleotide metabolic process |
| purine nucleotide biosynthetic process |
| purine nucleoside triphosphate biosynthetic process |
| purine ribonucleoside triphosphate biosynthetic process |
| gtp biosynthetic process |
| metabolic process |
| nitrogen compound metabolic process |
| cellular nitrogen compound metabolic process |
| nucleobase, nucleoside, nucleotide and nucleic acid metabolic process |
| nucleobase, nucleoside and nucleotide metabolic process |
| nucleoside phosphate metabolic process |
| nucleotide metabolic process |
| ctp biosynthetic process |
| pyrimidine nucleoside triphosphate biosynthetic process |
| pyrimidine nucleotide metabolic process |
| pyrimidine ribonucleoside triphosphate biosynthetic process |
| pyrimidine nucleotide biosynthetic process |
| utp biosynthetic process |
|
| Cellular Location
|
- Nucleus
- Cytoplasm
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Lactose Synthesis |    | Not Available | | Congenital disorder of glycosylation CDG-IId |    | Not Available | | GLUT-1 deficiency syndrome |    | Not Available | | Tenofovir Metabolism Pathway |    | Not Available | | Adefovir Dipivoxil Metabolism Pathway |    | Not Available |
|
| Gene Properties |
| Chromosome Location
| 17 |
| Locus
| 17q21.3 |
| SNPs
| NME2 |
| Gene Sequence
|
>459 bp
ATGGCCAACCTGGAGCGCACCTTCATCGCCATCAAGCCGGACGGCGTGCAGCGCGGCCTG
GTGGGCGAGATCATCAAGCGCTTCGAGCAGAAGGGATTCCGCCTCGTGGCCATGAAGTTC
CTCCGGGCCTCTGAAGAACACCTGAAGCAGCACTACATTGACCTGAAAGACCGACCATTC
TTCCCTGGGCTGGTGAAGTACATGAACTCAGGGCCGGTTGTGGCCATGGTCTGGGAGGGG
CTGAACGTGGTGAAGACAGGCCGAGTGATGCTTGGGGAGACCAATCCAGCAGATTCAAAG
CCAGGCACCATTCGTGGGGACTTCTGCATTCAGGTTGGCAGGAACATCATTCATGGCAGT
GATTCAGTAAAAAGTGCTGAAAAAGAAATCAGCCTATGGTTTAAGCCTGAAGAACTGGTT
GACTACAAGTCTTGTGCTCATGACTGGGTCTATGAATAA
|
| Protein Properties |
| Number of Residues
| 152 |
| Molecular Weight
| 30136.92 |
| Theoretical pI
| 8.93 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Nucleoside diphosphate kinase B
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF
FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
|
| External Links |
| GenBank ID Protein
| 4467843 |
| UniProtKB/Swiss-Prot ID
| P22392 |
| UniProtKB/Swiss-Prot Entry Name
| NDKB_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| X58965 |
| GeneCard ID
| NME2 |
| GenAtlas ID
| NME2 |
| HGNC ID
| HGNC:7850 |
| References |
| General References
| Not Available |