| Identification |
| HMDB Protein ID
| CDBP00097 |
| Secondary Accession Numbers
| Not Available |
| Name
| Macrophage migration inhibitory factor |
| Description
| Not Available |
| Synonyms
|
- GIF
- Glycosylation-inhibiting factor
- L-dopachrome isomerase
- L-dopachrome tautomerase
- MIF
- Phenylpyruvate tautomerase
|
| Gene Name
| MIF |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in cell surface binding |
| Specific Function
| Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
|
| GO Classification
|
| Biological Process |
| positive regulation of peptidyl-tyrosine phosphorylation |
| cell surface receptor signaling pathway |
| innate immune response |
| positive regulation of B cell proliferation |
| protein homotrimerization |
| negative regulation of cell aging |
| negative regulation of cell cycle arrest |
| negative regulation of DNA damage response, signal transduction by p53 class mediator |
| negative regulation of gene expression |
| positive regulation of cytokine secretion |
| positive regulation of peptidyl-serine phosphorylation |
| negative regulation of apoptotic process |
| positive regulation of protein kinase A signaling cascade |
| positive regulation of fibroblast proliferation |
| regulation of macrophage activation |
| cell proliferation |
| prostaglandin biosynthetic process |
| inflammatory response |
| positive regulation of ERK1 and ERK2 cascade |
| Cellular Component |
| extracellular region |
| extracellular space |
| cell surface |
| cytoplasm |
| Molecular Function |
| chemoattractant activity |
| dopachrome isomerase activity |
| cell surface binding |
| cytokine activity |
| phenylpyruvate tautomerase activity |
|
| Cellular Location
|
- Cytoplasm
- Secreted
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Tyrosine Metabolism |    |  | | Phenylalanine metabolism | Not Available |  | | Alkaptonuria |    | Not Available | | Hawkinsinuria |    | Not Available | | Tyrosinemia Type I |    | Not Available |
|
| Gene Properties |
| Chromosome Location
| 22 |
| Locus
| 22q11.23 |
| SNPs
| MIF |
| Gene Sequence
|
>348 bp
ATGCCGATGTTCATCGTAAACACCAACGTGCCCCGCGCCTCCGTGCCGGACGGGTTCCTC
TCCGAGCTCACCCAGCAGCTGGCGCAGGCCACCGGCAAGCCCCCCCAGTACATCGCGGTG
CACGTGGTCCCGGACCAGCTCATGGCCTTCGGCGGCTCCAGCGAGCCGTGCGCGCTCTGC
AGCCTGCACAGCATCGGCAAGATCGGCGGCGCGCAGAACCGCTCCTACAGCAAGCTGCTG
TGCGGCCTGCTGGCCGAGCGCCTGCGCATCAGCCCGGACAGGGTCTACATCAACTATTAC
GACATGAACGCGGCCAATGTGGGCTGGAACAACTCCACCTTCGCCTAA
|
| Protein Properties |
| Number of Residues
| 115 |
| Molecular Weight
| 12476.19 |
| Theoretical pI
| 7.885 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Macrophage migration inhibitory factor
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
| External Links |
| GenBank ID Protein
| 18699569 |
| UniProtKB/Swiss-Prot ID
| P14174 |
| UniProtKB/Swiss-Prot Entry Name
| MIF_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| AF469046 |
| GeneCard ID
| MIF |
| GenAtlas ID
| MIF |
| HGNC ID
| HGNC:7097 |
| References |
| General References
| Not Available |