| Identification |
|---|
| HMDB Protein ID
| CDBP00059 |
| Secondary Accession Numbers
| Not Available |
| Name
| Phospholipase A2 |
| Description
| Not Available |
| Synonyms
|
- Group IB phospholipase A2
- Phosphatidylcholine 2-acylhydrolase 1B
|
| Gene Name
| PLA2G1B |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in phospholipase A2 activity |
| Specific Function
| PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
|
| GO Classification
|
| Biological Process |
| positive regulation of transcription from RNA polymerase II promoter |
| phosphatidylinositol acyl-chain remodeling |
| phosphatidic acid biosynthetic process |
| phosphatidylserine acyl-chain remodeling |
| leukotriene biosynthetic process |
| actin filament organization |
| positive regulation of NF-kappaB transcription factor activity |
| positive regulation of DNA replication |
| phosphatidylglycerol acyl-chain remodeling |
| positive regulation of fibroblast proliferation |
| activation of MAPK activity |
| positive regulation of calcium ion transport into cytosol |
| neutrophil mediated immunity |
| positive regulation of protein secretion |
| glucose transport |
| intracellular protein kinase cascade |
| activation of phospholipase A2 activity |
| arachidonic acid secretion |
| interleukin-8 production |
| multicellular organismal lipid catabolic process |
| neutrophil chemotaxis |
| positive regulation of immune response |
| phosphatidylcholine acyl-chain remodeling |
| cellular response to insulin stimulus |
| phosphatidylethanolamine acyl-chain remodeling |
| Cellular Component |
| secretory granule |
| extracellular space |
| Function |
| calcium ion binding |
| carboxylesterase activity |
| phospholipase a2 activity |
| ion binding |
| cation binding |
| metal ion binding |
| hydrolase activity, acting on ester bonds |
| binding |
| catalytic activity |
| hydrolase activity |
| Molecular Function |
| receptor binding |
| calcium-dependent phospholipase A2 activity |
| bile acid binding |
| calcium ion binding |
| cell surface binding |
| Process |
| metabolic process |
| primary metabolic process |
| lipid metabolic process |
| lipid catabolic process |
| organophosphate metabolic process |
| phospholipid metabolic process |
|
| Cellular Location
|
- Secreted
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Arachidonic Acid Metabolism |    |  | | Glycerophospholipid metabolism | Not Available |  | | Ether lipid metabolism | Not Available |  | | Linoleic acid metabolism | Not Available |  | | alpha-Linolenic acid metabolism | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12q23-q24.1 |
| SNPs
| PLA2G1B |
| Gene Sequence
|
>447 bp
ATGAAACTCCTTGTGCTAGCTGTGCTGCTCACAGTGGCCGCCGCCGACAGCGGCATCAGC
CCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCC
TTCTTGGAATACAACAACTACGGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTG
GATGAACTGGACAAGTGCTGCCAGACACATGACAACTGCTATGACCAGGCCAAGAAGCTG
GACAGCTGTAAATTTCTGCTGGACAACCCGTACACCCACACCTATTCATACTCGTGCTCT
GGCTCGGCAATCACCTGTAGCAGCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTGC
GACCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCATATAACAAGGCACACAAGAACCTG
GACACCAAGAAGTATTGTCAGAGTTGA
|
| Protein Properties |
|---|
| Number of Residues
| 148 |
| Molecular Weight
| 16359.535 |
| Theoretical pI
| 7.849 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Phospholipase A2
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P04054 |
| UniProtKB/Swiss-Prot Entry Name
| PA21B_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| M21054 |
| GeneCard ID
| PLA2G1B |
| GenAtlas ID
| PLA2G1B |
| HGNC ID
| HGNC:9030 |
| References |
|---|
| General References
| Not Available |